PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_16446A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 427aa    MW: 46452.8 Da    PI: 6.5192
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_16446AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-1658102147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                r +WT+eE++++++a k++G   W+ I +++g ++t+ q++s+ qk+
  Oropetium_20150105_16446A  58 REKWTEEEHDKFLEALKLYGRS-WRQIQEHIG-TKTAVQIRSHAQKF 102
                                789*****************55.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.18E-1652106IPR009057Homeodomain-like
PROSITE profilePS5129421.58553107IPR017930Myb domain
TIGRFAMsTIGR015574.0E-1656105IPR006447Myb domain, plants
SMARTSM007172.9E-1457105IPR001005SANT/Myb domain
PfamPF002491.6E-1458101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-105898IPR009057Homeodomain-like
CDDcd001673.05E-1160103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MEAMAQVEER DGGADSSSLQ LPSDVVKPPL MDDGMRPKEG MDGYPVKVRK PYTITKQREK  60
WTEEEHDKFL EALKLYGRSW RQIQEHIGTK TAVQIRSHAQ KFFSKVVREP GAGNVIDIPP  120
PRPKRKPLHP YPRKCANAST MTKQASGQPK LAPVSPPSGS DQENGSPVSV LSAVQSDAFG  180
SSVSNPSTGC TSPASSDGGN NVRMMVTGDE ILPSKQTEMD QSPKEIKQDN SDGDLSEEDS  240
LRETSLKLFG KTVIIPDPKK ISSSHSGCGD DEKHTQSEKD TQLSYQEMFQ ATYAARNGWF  300
LPFHSFPFHM GESGDARISA LHVWWPYYGF PVSHPRELGG VLLGEGSGES DTGKSPSAES  360
SSDSLGNIQT TSEVVKDSIG AIQTPESALS FELKPSVNSA FVPVKRSCNG SQSTRGFVPY  420
KRCKVE*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966527.10.0PREDICTED: uncharacterized protein LOC101785788
TrEMBLK3XWZ90.0K3XWZ9_SETIT; Uncharacterized protein
STRINGSi006457m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77833647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.14e-41MYB_related family protein